PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G040600.2
Common NameB456_013G040600, LOC105783481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 326aa    MW: 36035.7 Da    PI: 7.2504
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G040600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1054.4e-33177232156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Gorai.013G040600.2 177 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 232
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.59E-18174235IPR009057Homeodomain-like
PROSITE profilePS5129413.494174234IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-29176235IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-27177232IPR006447Myb domain, plants
PfamPF002494.6E-8179230IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MARNVEPVLE EFIPLKNKEE DNHSEEDGSL ITTKKEEDCN NDCNNNMDKK NWMSSVQLWN  60
IDDDYCSSDH KLDTKRNDED PCKSRGGGGR GFMPFKANLG FAVRKEEKQE IPVHGLTLST  120
PGINNLKEES SSTGSRSSCS RAVPFSATNA RSSFQSAPPV GPSNHLQQHQ QQQTGRKQRR  180
CWSPELHRRF VNALQQLGGS QVATPKQIRE LMQVDGLTND EVKSHLQKYR LHTRRLPATT  240
TTTTPANQSG LVLGGGHAWM CQDQFGESSK GSSSQSGSPQ GPLQLATNTG GTSTTGCESM  300
EDDEDAKSEC YSWKNHVQKP RKNNV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9646121e-60JX964612.1 Gossypium hirsutum clone NBRI_TRANS-881 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464423.10.0PREDICTED: uncharacterized protein LOC105783481
TrEMBLA0A0D2W2N90.0A0A0D2W2N9_G
TrEMBLA0A0D2V8Z70.0A0A0D2V8Z7_G
STRINGVIT_03s0063g01060.t011e-111(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-32G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]